SCOP 1.57: Domain d1qnta1: 1qnt A:92-176

Lineage for d1qnta1 (1qnt A:92-176)

1. Root: SCOP 1.57

2. Class a: All alpha proteins [46456] (144 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (10 superfamilies)

4. Superfamily a.4.2: Methylated DNA-protein cysteine methyltransferase, C-terminal domain [46767] (1 family)

5. Family a.4.2.1: Methylated DNA-protein cysteine methyltransferase, C-terminal domain [46768] (2 proteins)

6. Protein O6-alkylguanine-DNA alkyltransferase [46771] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [46772] (4 PDB entries)

8. Domain d1qnta1: 1qnt A:92-176 [16074]
   Other proteins in same PDB: d1qnta2

Details for d1qnta1

PDB Entry: 1qnt, 1.9 Å

PDB Description: x-ray structure of human o6alkylguanine-dna alkyltransferase

SCOP Domain Sequences for d1qnta1:

Sequence; same for both SEQRES and ATOM records:

>d1qnta1 a.4.2.1 (A:92-176) O6-alkylguanine-DNA alkyltransferase {Human (Homo sapiens)}
esftrqvlwkllkvvkfgevisyqqlaalagnpkaaravggamrgnpvpilipchrvvcs
sgavgnysgglavkewllaheghrl

Timeline for d1qnta1:

• d1qnta1 first appeared (with stable ids) in SCOP 1.55
  
• d1qnta1 appears in SCOP 1.59
  
• d1qnta1 appears in the current release, SCOPe 2.08