![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.2: Methylated DNA-protein cysteine methyltransferase, C-terminal domain [46767] (2 families) ![]() automatically mapped to Pfam PF01035 |
![]() | Family a.4.2.1: Methylated DNA-protein cysteine methyltransferase, C-terminal domain [46768] (2 proteins) |
![]() | Protein Ada DNA repair protein [46769] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [46770] (1 PDB entry) |
![]() | Domain d1sfea1: 1sfe A:93-176 [16073] Other proteins in same PDB: d1sfea2 |
PDB Entry: 1sfe (more details), 2.1 Å
SCOPe Domain Sequences for d1sfea1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sfea1 a.4.2.1 (A:93-176) Ada DNA repair protein {Escherichia coli [TaxId: 562]} gtafqqqvwqalrtipcgetvsyqqlanaigkpkavravasacaanklaivipchrvvrg dgslsgyrwgvsrkaqllrreaen
Timeline for d1sfea1: