SCOPe 2.05: Domain d1sfea1: 1sfe A:93-176

Lineage for d1sfea1 (1sfe A:93-176)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.2: Methylated DNA-protein cysteine methyltransferase, C-terminal domain [46767] (2 families)
   automatically mapped to Pfam PF01035

5. Family a.4.2.1: Methylated DNA-protein cysteine methyltransferase, C-terminal domain [46768] (2 proteins)

6. Protein Ada DNA repair protein [46769] (1 species)

7. Species Escherichia coli [TaxId:562] [46770] (1 PDB entry)

8. Domain d1sfea1: 1sfe A:93-176 [16073]
   Other proteins in same PDB: d1sfea2

Details for d1sfea1

PDB Entry: 1sfe, 2.1 Å

PDB Description: ada o6-methylguanine-dna methyltransferase from escherichia coli

PDB Compounds: (A:) ada o6-methylguanine-DNA methyltransferase

SCOPe Domain Sequences for d1sfea1:

Sequence; same for both SEQRES and ATOM records:

>d1sfea1 a.4.2.1 (A:93-176) Ada DNA repair protein {Escherichia coli [TaxId: 562]}
gtafqqqvwqalrtipcgetvsyqqlanaigkpkavravasacaanklaivipchrvvrg
dgslsgyrwgvsrkaqllrreaen

Timeline for d1sfea1:

• d1sfea1 first appeared (with stable ids) in SCOP 1.55, called d1sfe_1
  
• d1sfea1 appears in SCOPe 2.04
  
• d1sfea1 appears in SCOPe 2.06
  
• d1sfea1 appears in the current release, SCOPe 2.08