Lineage for d1sfe_1 (1sfe 93-176)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 1223Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (11 superfamilies)
  4. 1404Superfamily a.4.2: Methylated DNA-protein cysteine methyltransferase, C-terminal domain [46767] (1 family) (S)
  5. 1405Family a.4.2.1: Methylated DNA-protein cysteine methyltransferase, C-terminal domain [46768] (2 proteins)
  6. 1406Protein Ada DNA repair protein [46769] (1 species)
  7. 1407Species Escherichia coli [TaxId:562] [46770] (1 PDB entry)
  8. 1408Domain d1sfe_1: 1sfe 93-176 [16073]
    Other proteins in same PDB: d1sfe_2

Details for d1sfe_1

PDB Entry: 1sfe (more details), 2.1 Å

PDB Description: ada o6-methylguanine-dna methyltransferase from escherichia coli

SCOP Domain Sequences for d1sfe_1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sfe_1 a.4.2.1 (93-176) Ada DNA repair protein {Escherichia coli}
gtafqqqvwqalrtipcgetvsyqqlanaigkpkavravasacaanklaivipchrvvrg
dgslsgyrwgvsrkaqllrreaen

SCOP Domain Coordinates for d1sfe_1:

Click to download the PDB-style file with coordinates for d1sfe_1.
(The format of our PDB-style files is described here.)

Timeline for d1sfe_1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1sfe_2