Lineage for d1du7a1 (1du7 A:2-67)
- Root: SCOP 1.57
Class a: All alpha proteins [46456] (144 folds) 
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (10 superfamilies) 
Superfamily a.4.1: Homeodomain-like [46689] (10 families) 
Family a.4.1.9: Tetracyclin repressor (Tet-repressor, TetR), N-terminal domain [46764] (1 protein) Protein Tetracyclin repressor (Tet-repressor, TetR), N-terminal domain [46765] (1 species) Species Escherichia coli [TaxId:562] [46766] (9 PDB entries) 
Domain d1du7a1: 1du7 A:2-67 [16071]
Other proteins in same PDB: d1du7a2
Details for d1du7a1
PDB Entry: 1du7 (more details), 2.51 Å
PDB Description: crystal structure of tet repressor class d with 4-epi-tetracycline
SCOP Domain Sequences for d1du7a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1du7a1 a.4.1.9 (A:2-67) Tetracyclin repressor (Tet-repressor, TetR), N-terminal domain {Escherichia coli}
srlnresvidaalellnetgidglttrklaqklgieqptlywhvknkralldalaveila
rhhdys
SCOP Domain Coordinates for d1du7a1:
Click to download the PDB-style file with coordinates for d1du7a1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1du7a1:
- d1du7a1 first appeared (with stable ids) in SCOP 1.55
- d1du7a1 appears in SCOP 1.59
- d1du7a1 last appears in SCOP 1.75
View in 3D
