![]() | Class a: All alpha proteins [46456] (226 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.1: Homeodomain-like [46689] (13 families) ![]() consists only of helices |
![]() | Family a.4.1.9: Tetracyclin repressor-like, N-terminal domain [46764] (9 proteins) |
![]() | Protein Tetracyclin repressor (Tet-repressor, TetR) [46765] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [46766] (9 PDB entries) |
![]() | Domain d1bjyb1: 1bjy B:2-67 [16070] Other proteins in same PDB: d1bjya2, d1bjyb2 complexed with ctc, mg; mutant |
PDB Entry: 1bjy (more details), 2.7 Å
SCOP Domain Sequences for d1bjyb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bjyb1 a.4.1.9 (B:2-67) Tetracyclin repressor (Tet-repressor, TetR) {Escherichia coli} srlnresvidaalellnetgidglttrklaqklgieqptlywhvknkralldalaveila rhhdys
Timeline for d1bjyb1: