Lineage for d1bjyb1 (1bjy B:2-67)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 45282Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (10 superfamilies)
  4. 45283Superfamily a.4.1: Homeodomain-like [46689] (10 families) (S)
  5. 45461Family a.4.1.9: Tetracyclin repressor (Tet-repressor, TetR), N-terminal domain [46764] (1 protein)
  6. 45462Protein Tetracyclin repressor (Tet-repressor, TetR), N-terminal domain [46765] (1 species)
  7. 45463Species Escherichia coli [TaxId:562] [46766] (9 PDB entries)
  8. 45471Domain d1bjyb1: 1bjy B:2-67 [16070]
    Other proteins in same PDB: d1bjya2, d1bjyb2

Details for d1bjyb1

PDB Entry: 1bjy (more details), 2.7 Å

PDB Description: tetracycline chelated mg2+-ion initiates helix unwinding for tet repressor induction

SCOP Domain Sequences for d1bjyb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bjyb1 a.4.1.9 (B:2-67) Tetracyclin repressor (Tet-repressor, TetR), N-terminal domain {Escherichia coli}
srlnresvidaalellnetgidglttrklaqklgieqptlywhvknkralldalaveila
rhhdys

SCOP Domain Coordinates for d1bjyb1:

Click to download the PDB-style file with coordinates for d1bjyb1.
(The format of our PDB-style files is described here.)

Timeline for d1bjyb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1bjyb2