SCOP 1.65: Domain d1bjya1: 1bjy A:2-67

Lineage for d1bjya1 (1bjy A:2-67)

1. Root: SCOP 1.65

2. Class a: All alpha proteins [46456] (179 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (12 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.1: Homeodomain-like [46689] (11 families)
   consists only of helices

5. Family a.4.1.9: Tetracyclin repressor-like, N-terminal domain [46764] (3 proteins)

6. Protein Tetracyclin repressor (Tet-repressor, TetR) [46765] (1 species)

7. Species Escherichia coli [TaxId:562] [46766] (9 PDB entries)

8. Domain d1bjya1: 1bjy A:2-67 [16069]
   Other proteins in same PDB: d1bjya2, d1bjyb2

Details for d1bjya1

PDB Entry: 1bjy, 2.7 Å

PDB Description: tetracycline chelated mg2+-ion initiates helix unwinding for tet repressor induction

SCOP Domain Sequences for d1bjya1:

Sequence; same for both SEQRES and ATOM records:

>d1bjya1 a.4.1.9 (A:2-67) Tetracyclin repressor (Tet-repressor, TetR) {Escherichia coli}
srlnresvidaalellnetgidglttrklaqklgieqptlywhvknkralldalaveila
rhhdys

Timeline for d1bjya1:

• d1bjya1 first appeared (with stable ids) in SCOP 1.55
  
• d1bjya1 appears in SCOP 1.63
  
• d1bjya1 appears in SCOP 1.67
  
• d1bjya1 last appears in SCOPe 2.04