SCOP 1.63: Domain d1bj0_1: 1bj0 2-67

Lineage for d1bj0_1 (1bj0 2-67)

1. Root: SCOP 1.63

2. Class a: All alpha proteins [46456] (171 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (11 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.1: Homeodomain-like [46689] (11 families)
   consists only of helices

5. Family a.4.1.9: Tetracyclin repressor-like, N-terminal domain [46764] (2 proteins)

6. Protein Tetracyclin repressor (Tet-repressor, TetR) [46765] (1 species)

7. Species Escherichia coli [TaxId:562] [46766] (9 PDB entries)

8. Domain d1bj0_1: 1bj0 2-67 [16068]
   Other proteins in same PDB: d1bj0_2
   complexed with ctc; mutant

Details for d1bj0_1

PDB Entry: 1bj0, 2.4 Å

PDB Description: tetracycline chelated mg2+-ion initiates helix unwinding for tet repressor induction

SCOP Domain Sequences for d1bj0_1:

Sequence; same for both SEQRES and ATOM records:

>d1bj0_1 a.4.1.9 (2-67) Tetracyclin repressor (Tet-repressor, TetR) {Escherichia coli}
srlnresvidaalellnetgidglttrklaqklgieqptlywhvknkralldalaveila
rhhdys

Timeline for d1bj0_1:

• d1bj0_1 first appeared (with stable ids) in SCOP 1.55
  
• d1bj0_1 appears in SCOP 1.61
  
• d1bj0_1 appears in SCOP 1.65
  
• d1bj0_1 last appears in SCOPe 2.04, called d1bj0a1