Lineage for d1bj0_1 (1bj0 2-67)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 1223Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (11 superfamilies)
  4. 1224Superfamily a.4.1: Homeodomain-like [46689] (9 families) (S)
  5. 1391Family a.4.1.9: Tetracyclin repressor (Tet-repressor, TetR), N-terminal domain [46764] (1 protein)
  6. 1392Protein Tetracyclin repressor (Tet-repressor, TetR), N-terminal domain [46765] (1 species)
  7. 1393Species Escherichia coli [TaxId:562] [46766] (9 PDB entries)
  8. 1399Domain d1bj0_1: 1bj0 2-67 [16068]
    Other proteins in same PDB: d1bj0_2

Details for d1bj0_1

PDB Entry: 1bj0 (more details), 2.4 Å

PDB Description: tetracycline chelated mg2+-ion initiates helix unwinding for tet repressor induction

SCOP Domain Sequences for d1bj0_1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bj0_1 a.4.1.9 (2-67) Tetracyclin repressor (Tet-repressor, TetR), N-terminal domain {Escherichia coli}
srlnresvidaalellnetgidglttrklaqklgieqptlywhvknkralldalaveila
rhhdys

SCOP Domain Coordinates for d1bj0_1:

Click to download the PDB-style file with coordinates for d1bj0_1.
(The format of our PDB-style files is described here.)

Timeline for d1bj0_1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1bj0_2