SCOP 1.69: Domain d1bjz_1: 1bjz 2-67

Lineage for d1bjz_1 (1bjz 2-67)

1. Root: SCOP 1.69

2. Class a: All alpha proteins [46456] (218 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (13 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.1: Homeodomain-like [46689] (13 families)
   consists only of helices

5. Family a.4.1.9: Tetracyclin repressor-like, N-terminal domain [46764] (9 proteins)

6. Protein Tetracyclin repressor (Tet-repressor, TetR) [46765] (1 species)

7. Species Escherichia coli [TaxId:562] [46766] (9 PDB entries)

8. Domain d1bjz_1: 1bjz 2-67 [16065]
   Other proteins in same PDB: d1bjz_2

Details for d1bjz_1

PDB Entry: 1bjz, 2.2 Å

PDB Description: tetracycline chelated mg2+-ion initiates helix unwinding for tet repressor induction

SCOP Domain Sequences for d1bjz_1:

Sequence; same for both SEQRES and ATOM records:

>d1bjz_1 a.4.1.9 (2-67) Tetracyclin repressor (Tet-repressor, TetR) {Escherichia coli}
srlnresvidaalellnetgidglttrklaqklgieqptlywhvknkralldalaveila
rhhdys

Timeline for d1bjz_1:

• d1bjz_1 first appeared (with stable ids) in SCOP 1.55
  
• d1bjz_1 appears in SCOP 1.67
  
• d1bjz_1 appears in SCOP 1.71
  
• d1bjz_1 appears in the current release, SCOPe 2.08, called d1bjza1