Lineage for d2trt_1 (2trt 2-67)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 532780Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 532781Superfamily a.4.1: Homeodomain-like [46689] (13 families) (S)
    consists only of helices
  5. 533063Family a.4.1.9: Tetracyclin repressor-like, N-terminal domain [46764] (9 proteins)
  6. 533143Protein Tetracyclin repressor (Tet-repressor, TetR) [46765] (1 species)
  7. 533144Species Escherichia coli [TaxId:562] [46766] (9 PDB entries)
  8. 533148Domain d2trt_1: 2trt 2-67 [16064]
    Other proteins in same PDB: d2trt_2
    complexed with mg, tac

Details for d2trt_1

PDB Entry: 2trt (more details), 2.5 Å

PDB Description: tetracycline repressor class d

SCOP Domain Sequences for d2trt_1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2trt_1 a.4.1.9 (2-67) Tetracyclin repressor (Tet-repressor, TetR) {Escherichia coli}
arlnresvidaalellnetgidglttrklaqklgieqptlywhvknkralldalaveila
rhhdys

SCOP Domain Coordinates for d2trt_1:

Click to download the PDB-style file with coordinates for d2trt_1.
(The format of our PDB-style files is described here.)

Timeline for d2trt_1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2trt_2