SCOP 1.63: Domain d2tct_1: 2tct 2-67

Lineage for d2tct_1 (2tct 2-67)

1. Root: SCOP 1.63

2. Class a: All alpha proteins [46456] (171 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (11 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.1: Homeodomain-like [46689] (11 families)
   consists only of helices

5. Family a.4.1.9: Tetracyclin repressor-like, N-terminal domain [46764] (2 proteins)

6. Protein Tetracyclin repressor (Tet-repressor, TetR) [46765] (1 species)

7. Species Escherichia coli [TaxId:562] [46766] (9 PDB entries)

8. Domain d2tct_1: 2tct 2-67 [16063]
   Other proteins in same PDB: d2tct_2
   complexed with ctc, mg

Details for d2tct_1

PDB Entry: 2tct, 2.1 Å

PDB Description: the complex formed between tet repressor and tetracycline-mg2+ reveals mechanism of antibiotic resistance

SCOP Domain Sequences for d2tct_1:

Sequence; same for both SEQRES and ATOM records:

>d2tct_1 a.4.1.9 (2-67) Tetracyclin repressor (Tet-repressor, TetR) {Escherichia coli}
arlnresvidaalellnetgidglttrklaqklgieqptlywhvknkralldalaveila
rhhdys

Timeline for d2tct_1:

• d2tct_1 first appeared (with stable ids) in SCOP 1.55
  
• d2tct_1 appears in SCOP 1.61
  
• d2tct_1 appears in SCOP 1.65
  
• d2tct_1 appears in the current release, SCOPe 2.08, called d2tcta1