Lineage for d2tct_1 (2tct 2-67)

  1. Root: SCOP 1.63
  2. 208553Class a: All alpha proteins [46456] (171 folds)
  3. 210246Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (11 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 210247Superfamily a.4.1: Homeodomain-like [46689] (11 families) (S)
    consists only of helices
  5. 210478Family a.4.1.9: Tetracyclin repressor-like, N-terminal domain [46764] (2 proteins)
  6. 210509Protein Tetracyclin repressor (Tet-repressor, TetR) [46765] (1 species)
  7. 210510Species Escherichia coli [TaxId:562] [46766] (9 PDB entries)
  8. 210511Domain d2tct_1: 2tct 2-67 [16063]
    Other proteins in same PDB: d2tct_2
    complexed with ctc, mg

Details for d2tct_1

PDB Entry: 2tct (more details), 2.1 Å

PDB Description: the complex formed between tet repressor and tetracycline-mg2+ reveals mechanism of antibiotic resistance

SCOP Domain Sequences for d2tct_1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2tct_1 a.4.1.9 (2-67) Tetracyclin repressor (Tet-repressor, TetR) {Escherichia coli}
arlnresvidaalellnetgidglttrklaqklgieqptlywhvknkralldalaveila
rhhdys

SCOP Domain Coordinates for d2tct_1:

Click to download the PDB-style file with coordinates for d2tct_1.
(The format of our PDB-style files is described here.)

Timeline for d2tct_1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2tct_2