Lineage for d1d5yc1 (1d5y C:3-56)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 45282Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (10 superfamilies)
  4. 45283Superfamily a.4.1: Homeodomain-like [46689] (10 families) (S)
  5. 45446Family a.4.1.8: AraC type transcriptional activator [46759] (2 proteins)
  6. 45451Protein Rob transcription factor, N-terminal domain [46762] (1 species)
  7. 45452Species Escherichia coli [TaxId:562] [46763] (1 PDB entry)
  8. 45457Domain d1d5yc1: 1d5y C:3-56 [16059]
    Other proteins in same PDB: d1d5ya3, d1d5yb3, d1d5yc3, d1d5yd3

Details for d1d5yc1

PDB Entry: 1d5y (more details), 2.7 Å

PDB Description: crystal structure of the e. coli rob transcription factor in complex with dna
PDB Compounds: (C:)

SCOP Domain Sequences for d1d5yc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d5yc1 a.4.1.8 (C:3-56) Rob transcription factor, N-terminal domain {Escherichia coli}
qagiirdlliwleghldqplsldnvaakagyskwhlqrmfkdvtghaigayira

SCOP Domain Coordinates for d1d5yc1:

Click to download the PDB-style file with coordinates for d1d5yc1.
(The format of our PDB-style files is described here.)

Timeline for d1d5yc1: