Lineage for d1bl0a2 (1bl0 A:63-124)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 1223Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (11 superfamilies)
  4. 1224Superfamily a.4.1: Homeodomain-like [46689] (9 families) (S)
  5. 1376Family a.4.1.8: AraC type transcriptional activator [46759] (2 protein domains)
  6. 1377Protein MarA [46760] (1 species)
  7. 1378Species Escherichia coli [TaxId:562] [46761] (1 PDB entry)
  8. 1380Domain d1bl0a2: 1bl0 A:63-124 [16054]

Details for d1bl0a2

PDB Entry: 1bl0 (more details), 2.3 Å

PDB Description: multiple antibiotic resistance protein (mara)/dna complex

SCOP Domain Sequences for d1bl0a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bl0a2 a.4.1.8 (A:63-124) MarA {Escherichia coli}
rkmteiaqklkesnepilylaerygfesqqtltrtfknyfdvpphkyrmtnmqgesrflh
pl

SCOP Domain Coordinates for d1bl0a2:

Click to download the PDB-style file with coordinates for d1bl0a2.
(The format of our PDB-style files is described here.)

Timeline for d1bl0a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1bl0a1