Lineage for d1bw6a_ (1bw6 A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2691778Superfamily a.4.1: Homeodomain-like [46689] (21 families) (S)
    consists only of helices
  5. 2692185Family a.4.1.7: Centromere-binding [46756] (2 proteins)
    duplication: tandem repeat of two similar domains
  6. 2692190Protein DNA-binding domain of centromere binding protein B (CENP-B) [46757] (1 species)
  7. 2692191Species Human (Homo sapiens) [TaxId:9606] [46758] (2 PDB entries)
  8. 2692194Domain d1bw6a_: 1bw6 A: [16052]
    the N-terminal domain only

Details for d1bw6a_

PDB Entry: 1bw6 (more details)

PDB Description: human centromere protein b (cenp-b) dna bindign domain rp1
PDB Compounds: (A:) protein (centromere protein b)

SCOPe Domain Sequences for d1bw6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bw6a_ a.4.1.7 (A:) DNA-binding domain of centromere binding protein B (CENP-B) {Human (Homo sapiens) [TaxId: 9606]}
mgpkrrqltfreksriiqeveenpdlrkgeiarrfnippstlstilknkrailase

SCOPe Domain Coordinates for d1bw6a_:

Click to download the PDB-style file with coordinates for d1bw6a_.
(The format of our PDB-style files is described here.)

Timeline for d1bw6a_: