SCOP 1.69: Domain d1ba5__: 1ba5 -

Lineage for d1ba5__ (1ba5 -)

1. Root: SCOP 1.69

2. Class a: All alpha proteins [46456] (218 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (13 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.1: Homeodomain-like [46689] (13 families)
   consists only of helices

5. Family a.4.1.4: DNA-binding domain of human telomeric protein, hTRF1 [46745] (1 protein)

6. Protein DNA-binding domain of human telomeric protein, hTRF1 [46746] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [46747] (3 PDB entries)

8. Domain d1ba5__: 1ba5 - [16045]

Details for d1ba5__

PDB Entry: 1ba5

PDB Description: dna-binding domain of human telomeric protein, htrf1, nmr, 18 structures

SCOP Domain Sequences for d1ba5__:

Sequence; same for both SEQRES and ATOM records:

>d1ba5__ a.4.1.4 (-) DNA-binding domain of human telomeric protein, hTRF1 {Human (Homo sapiens)}
rkrqawlweedknlrsgvrkygegnwskillhykfnnrtsvmlkdrwrtmkkl

Timeline for d1ba5__:

• d1ba5__ first appeared (with stable ids) in SCOP 1.55
  
• d1ba5__ appears in SCOP 1.67
  
• d1ba5__ appears in SCOP 1.71
  
• d1ba5__ appears in the current release, SCOPe 2.08, called d1ba5a_