Lineage for d1ba5__ (1ba5 -)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 1223Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (11 superfamilies)
  4. 1224Superfamily a.4.1: Homeodomain-like [46689] (9 families) (S)
  5. 1354Family a.4.1.4: DNA-binding domain of human telomeric protein, htrf1 [46745] (1 protein)
  6. 1355Protein DNA-binding domain of human telomeric protein, htrf1 [46746] (1 species)
  7. 1356Species Human (Homo sapiens) [TaxId:9606] [46747] (1 PDB entry)
  8. 1357Domain d1ba5__: 1ba5 - [16045]

Details for d1ba5__

PDB Entry: 1ba5 (more details)

PDB Description: dna-binding domain of human telomeric protein, htrf1, nmr, 18 structures

SCOP Domain Sequences for d1ba5__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ba5__ a.4.1.4 (-) DNA-binding domain of human telomeric protein, htrf1 {Human (Homo sapiens)}
rkrqawlweedknlrsgvrkygegnwskillhykfnnrtsvmlkdrwrtmkkl

SCOP Domain Coordinates for d1ba5__:

Click to download the PDB-style file with coordinates for d1ba5__.
(The format of our PDB-style files is described here.)

Timeline for d1ba5__: