Class a: All alpha proteins [46456] (286 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.1: Homeodomain-like [46689] (20 families) consists only of helices |
Family a.4.1.3: Myb/SANT domain [46739] (16 proteins) |
Protein b-Myb DNA binding domain [46743] (1 species) |
Species Chicken (Gallus gallus) [TaxId:9031] [46744] (1 PDB entry) |
Domain d1a5ja2: 1a5j A:56-110 [16044] repeats 2 & 3 |
PDB Entry: 1a5j (more details)
SCOPe Domain Sequences for d1a5ja2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1a5ja2 a.4.1.3 (A:56-110) b-Myb DNA binding domain {Chicken (Gallus gallus) [TaxId: 9031]} evkksswteeedriifeahkvlgnrwaeiakllpgrtdnavknhwnstikrkvdt
Timeline for d1a5ja2: