SCOPe 2.07: Domain d1a5ja1: 1a5j A:1-55

Lineage for d1a5ja1 (1a5j A:1-55)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.1: Homeodomain-like [46689] (20 families)
   consists only of helices

5. Family a.4.1.3: Myb/SANT domain [46739] (16 protein domains)

6. Protein b-Myb DNA binding domain [46743] (1 species)

7. Species Chicken (Gallus gallus) [TaxId:9031] [46744] (1 PDB entry)

8. Domain d1a5ja1: 1a5j A:1-55 [16043]
   repeats 2 & 3

Details for d1a5ja1

PDB Entry: 1a5j

PDB Description: chicken b-myb dna binding domain, repeat 2 and repeat3, nmr, 32 structures

PDB Compounds: (A:) b-myb

SCOPe Domain Sequences for d1a5ja1:

Sequence; same for both SEQRES and ATOM records:

>d1a5ja1 a.4.1.3 (A:1-55) b-Myb DNA binding domain {Chicken (Gallus gallus) [TaxId: 9031]}
gipdlvkgpwtkeedqkvielvkkygtkqwtliakhlkgrlgkqcrerwhnhlnp

Timeline for d1a5ja1:

• d1a5ja1 first appeared (with stable ids) in SCOP 1.55, called d1a5j_1
  
• d1a5ja1 appears in SCOPe 2.06