![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.1: Homeodomain-like [46689] (21 families) ![]() consists only of helices |
![]() | Family a.4.1.3: Myb/SANT domain [46739] (16 proteins) |
![]() | Protein b-Myb DNA binding domain [46743] (1 species) |
![]() | Species Chicken (Gallus gallus) [TaxId:9031] [46744] (1 PDB entry) |
![]() | Domain d1a5ja1: 1a5j A:1-55 [16043] repeats 2 & 3 |
PDB Entry: 1a5j (more details)
SCOPe Domain Sequences for d1a5ja1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1a5ja1 a.4.1.3 (A:1-55) b-Myb DNA binding domain {Chicken (Gallus gallus) [TaxId: 9031]} gipdlvkgpwtkeedqkvielvkkygtkqwtliakhlkgrlgkqcrerwhnhlnp
Timeline for d1a5ja1: