SCOPe 2.03: Domain d1msfc2: 1msf C:144-193

Lineage for d1msfc2 (1msf C:144-193)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.1: Homeodomain-like [46689] (20 families)
   consists only of helices

5. Family a.4.1.3: Myb/SANT domain [46739] (15 proteins)

6. Protein c-Myb, DNA-binding domain [46740] (1 species)
   duplication

7. Species Mouse (Mus musculus) [TaxId:10090] [46742] (16 PDB entries)

8. Domain d1msfc2: 1msf C:144-193 [16042]
   repeats 2 & 3
   protein/DNA complex

Details for d1msfc2

PDB Entry: 1msf

PDB Description: solution structure of a specific dna complex of the myb dna-binding domain with cooperative recognition helices

PDB Compounds: (C:) C-Myb DNA-Binding Domain

SCOPe Domain Sequences for d1msfc2:

Sequence; same for both SEQRES and ATOM records:

>d1msfc2 a.4.1.3 (C:144-193) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]}
ktswteeedriiyqahkrlgnrwaeiakllpgrtdnaiknhwnstmrrkv

Timeline for d1msfc2:

• d1msfc2 first appeared (with stable ids) in SCOP 1.55
  
• d1msfc2 appears in SCOPe 2.02
  
• d1msfc2 appears in SCOPe 2.04
  
• d1msfc2 appears in the current release, SCOPe 2.08