Lineage for d1msfc2 (1msf C:144-193)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 45282Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (10 superfamilies)
  4. 45283Superfamily a.4.1: Homeodomain-like [46689] (10 families) (S)
  5. 45400Family a.4.1.3: Myb [46739] (3 proteins)
  6. 45405Protein c-Myb, DNA-binding domain [46740] (2 species)
  7. 45408Species Mouse (Mus musculus) [TaxId:10090] [46742] (10 PDB entries)
  8. 45420Domain d1msfc2: 1msf C:144-193 [16042]

Details for d1msfc2

PDB Entry: 1msf (more details)

PDB Description: solution structure of a specific dna complex of the myb dna-binding domain with cooperative recognition helices

SCOP Domain Sequences for d1msfc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1msfc2 a.4.1.3 (C:144-193) c-Myb, DNA-binding domain {Mouse (Mus musculus)}
ktswteeedriiyqahkrlgnrwaeiakllpgrtdnaiknhwnstmrrkv

SCOP Domain Coordinates for d1msfc2:

Click to download the PDB-style file with coordinates for d1msfc2.
(The format of our PDB-style files is described here.)

Timeline for d1msfc2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1msfc1