Lineage for d1msfc1 (1msf C:89-143)

  1. Root: SCOP 1.59
  2. 93448Class a: All alpha proteins [46456] (151 folds)
  3. 94900Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (10 superfamilies)
  4. 94901Superfamily a.4.1: Homeodomain-like [46689] (10 families) (S)
  5. 95027Family a.4.1.3: Myb [46739] (4 proteins)
  6. 95032Protein c-Myb, DNA-binding domain [46740] (2 species)
  7. 95035Species Mouse (Mus musculus) [TaxId:10090] [46742] (12 PDB entries)
  8. 95049Domain d1msfc1: 1msf C:89-143 [16041]

Details for d1msfc1

PDB Entry: 1msf (more details)

PDB Description: solution structure of a specific dna complex of the myb dna-binding domain with cooperative recognition helices

SCOP Domain Sequences for d1msfc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1msfc1 a.4.1.3 (C:89-143) c-Myb, DNA-binding domain {Mouse (Mus musculus)}
mlikgpwtkeedqrviklvqkygpkrwsviakhlkgrigkqcrerwhnhlnpevk

SCOP Domain Coordinates for d1msfc1:

Click to download the PDB-style file with coordinates for d1msfc1.
(The format of our PDB-style files is described here.)

Timeline for d1msfc1:

95049
d1msfc1 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d1msfc2