Lineage for d1msec1 (1mse C:89-143)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 1223Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (11 superfamilies)
  4. 1224Superfamily a.4.1: Homeodomain-like [46689] (9 families) (S)
  5. 1333Family a.4.1.3: Myb [46739] (2 proteins)
  6. 1338Protein c-Myb, DNA-binding domain [46740] (2 species)
  7. 1341Species Mouse (Mus musculus) [TaxId:10090] [46742] (10 PDB entries)
  8. 1350Domain d1msec1: 1mse C:89-143 [16039]

Details for d1msec1

PDB Entry: 1mse (more details)

PDB Description: solution structure of a specific dna complex of the myb dna-binding domain with cooperative recognition helices

SCOP Domain Sequences for d1msec1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1msec1 a.4.1.3 (C:89-143) c-Myb, DNA-binding domain {Mouse (Mus musculus)}
mlikgpwtkeedqrviklvqkygpkrwsviakhlkgrigkqcrerwhnhlnpevk

SCOP Domain Coordinates for d1msec1:

Click to download the PDB-style file with coordinates for d1msec1.
(The format of our PDB-style files is described here.)

Timeline for d1msec1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1msec2