Lineage for d1mbf__ (1mbf -)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 438099Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (13 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 438100Superfamily a.4.1: Homeodomain-like [46689] (13 families) (S)
    consists only of helices
  5. 438260Family a.4.1.3: Myb/SANT domain [46739] (6 proteins)
  6. 438268Protein c-Myb, DNA-binding domain [46740] (1 species)
    duplication
  7. 438269Species Mouse (Mus musculus) [TaxId:10090] [46742] (16 PDB entries)
  8. 438287Domain d1mbf__: 1mbf - [16037]
    repeat 1

Details for d1mbf__

PDB Entry: 1mbf (more details)

PDB Description: mouse c-myb dna-binding domain repeat 1

SCOP Domain Sequences for d1mbf__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mbf__ a.4.1.3 (-) c-Myb, DNA-binding domain {Mouse (Mus musculus)}
lgktrwtreedeklkklveqngtddwkvianylpnrtdvqcqhrwqkvlnpe

SCOP Domain Coordinates for d1mbf__:

Click to download the PDB-style file with coordinates for d1mbf__.
(The format of our PDB-style files is described here.)

Timeline for d1mbf__: