Lineage for d1mbh__ (1mbh -)

  1. Root: SCOP 1.63
  2. 208553Class a: All alpha proteins [46456] (171 folds)
  3. 210246Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (11 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 210247Superfamily a.4.1: Homeodomain-like [46689] (11 families) (S)
    consists only of helices
  5. 210389Family a.4.1.3: Myb [46739] (4 proteins)
  6. 210394Protein c-Myb, DNA-binding domain [46740] (2 species)
    duplication
  7. 210397Species Mouse (Mus musculus) [TaxId:10090] [46742] (12 PDB entries)
  8. 210407Domain d1mbh__: 1mbh - [16036]
    repeat 2
    complexed with nh2

Details for d1mbh__

PDB Entry: 1mbh (more details)

PDB Description: mouse c-myb dna-binding domain repeat 2

SCOP Domain Sequences for d1mbh__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mbh__ a.4.1.3 (-) c-Myb, DNA-binding domain {Mouse (Mus musculus)}
likgpwtkeedqrvielvqkygpkrwsviakhlkgrigkqcrerwhnhlnpe

SCOP Domain Coordinates for d1mbh__:

Click to download the PDB-style file with coordinates for d1mbh__.
(The format of our PDB-style files is described here.)

Timeline for d1mbh__: