Lineage for d1mbj__ (1mbj -)
- Root: SCOP 1.59
Class a: All alpha proteins [46456] (151 folds) 
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (10 superfamilies) 
Superfamily a.4.1: Homeodomain-like [46689] (10 families) 
Family a.4.1.3: Myb [46739] (4 proteins) 
Protein c-Myb, DNA-binding domain [46740] (2 species) Species Mouse (Mus musculus) [TaxId:10090] [46742] (12 PDB entries) 
Domain d1mbj__: 1mbj - [16035]
Details for d1mbj__
PDB Entry: 1mbj (more details)
PDB Description: mouse c-myb dna-binding domain repeat 3
SCOP Domain Sequences for d1mbj__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mbj__ a.4.1.3 (-) c-Myb, DNA-binding domain {Mouse (Mus musculus)}
vkktswteeedriiyqahkrlgnrwaeiakllpgrtdnaiknhwnstmrrkv
SCOP Domain Coordinates for d1mbj__:
Click to download the PDB-style file with coordinates for d1mbj__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1mbj__:
- d1mbj__ first appeared (with stable ids) in SCOP 1.55
- d1mbj__ appears in SCOP 1.57
- d1mbj__ appears in SCOP 1.61
- d1mbj__ appears in the current release, SCOPe 2.08, called d1mbja_
View in 3D