Lineage for d1mbj__ (1mbj -)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 1223Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (11 superfamilies)
  4. 1224Superfamily a.4.1: Homeodomain-like [46689] (9 families) (S)
  5. 1333Family a.4.1.3: Myb [46739] (2 proteins)
  6. 1338Protein c-Myb, DNA-binding domain [46740] (2 species)
  7. 1341Species Mouse (Mus musculus) [TaxId:10090] [46742] (10 PDB entries)
  8. 1346Domain d1mbj__: 1mbj - [16035]

Details for d1mbj__

PDB Entry: 1mbj (more details)

PDB Description: mouse c-myb dna-binding domain repeat 3

SCOP Domain Sequences for d1mbj__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mbj__ a.4.1.3 (-) c-Myb, DNA-binding domain {Mouse (Mus musculus)}
vkktswteeedriiyqahkrlgnrwaeiakllpgrtdnaiknhwnstmrrkv

SCOP Domain Coordinates for d1mbj__:

Click to download the PDB-style file with coordinates for d1mbj__.
(The format of our PDB-style files is described here.)

Timeline for d1mbj__: