Lineage for d1mbga_ (1mbg A:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1720410Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1720411Superfamily a.4.1: Homeodomain-like [46689] (20 families) (S)
    consists only of helices
  5. 1720667Family a.4.1.3: Myb/SANT domain [46739] (16 proteins)
  6. 1720675Protein c-Myb, DNA-binding domain [46740] (1 species)
    duplication
  7. 1720676Species Mouse (Mus musculus) [TaxId:10090] [46742] (16 PDB entries)
  8. 1720689Domain d1mbga_: 1mbg A: [16033]
    repeat 2

Details for d1mbga_

PDB Entry: 1mbg (more details)

PDB Description: mouse c-myb dna-binding domain repeat 2
PDB Compounds: (A:) Myb proto-oncogene protein

SCOPe Domain Sequences for d1mbga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mbga_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]}
likgpwtkeedqrvielvqkygpkrwsviakhlkgrigkqcrerwhnhlnpe

SCOPe Domain Coordinates for d1mbga_:

Click to download the PDB-style file with coordinates for d1mbga_.
(The format of our PDB-style files is described here.)

Timeline for d1mbga_: