Lineage for d2ezha_ (2ezh A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2691778Superfamily a.4.1: Homeodomain-like [46689] (21 families) (S)
    consists only of helices
  5. 2691999Family a.4.1.2: Recombinase DNA-binding domain [46728] (5 proteins)
  6. 2692028Protein Transposase [46737] (1 species)
  7. 2692029Species Bacteriophage Mu [TaxId:10677] [46738] (2 PDB entries)
  8. 2692031Domain d2ezha_: 2ezh A: [16029]

Details for d2ezha_

PDB Entry: 2ezh (more details)

PDB Description: solution nmr structure of the igamma subdomain of the mu end dna binding domain of mu phage transposase, minimized average structure
PDB Compounds: (A:) transposase

SCOPe Domain Sequences for d2ezha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ezha_ a.4.1.2 (A:) Transposase {Bacteriophage Mu [TaxId: 10677]}
sefdedawqfliadylrpekpafrkcyerlelaarehgwsipsratafrriqqldeamvv
acreg

SCOPe Domain Coordinates for d2ezha_:

Click to download the PDB-style file with coordinates for d2ezha_.
(The format of our PDB-style files is described here.)

Timeline for d2ezha_: