SCOPe 2.07: Domain d2ezha_: 2ezh A:

Lineage for d2ezha_ (2ezh A:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.1: Homeodomain-like [46689] (20 families)
   consists only of helices

5. Family a.4.1.2: Recombinase DNA-binding domain [46728] (5 protein domains)

6. Protein Transposase [46737] (1 species)

7. Species Bacteriophage Mu [TaxId:10677] [46738] (2 PDB entries)

8. Domain d2ezha_: 2ezh A: [16029]

Details for d2ezha_

PDB Entry: 2ezh

PDB Description: solution nmr structure of the igamma subdomain of the mu end dna binding domain of mu phage transposase, minimized average structure

PDB Compounds: (A:) transposase

SCOPe Domain Sequences for d2ezha_:

Sequence; same for both SEQRES and ATOM records:

>d2ezha_ a.4.1.2 (A:) Transposase {Bacteriophage Mu [TaxId: 10677]}
sefdedawqfliadylrpekpafrkcyerlelaarehgwsipsratafrriqqldeamvv
acreg

Timeline for d2ezha_:

• d2ezha_ first appeared (with stable ids) in SCOP 1.55, called d2ezh__
  
• d2ezha_ appears in SCOPe 2.06