| Class a: All alpha proteins [46456] (289 folds) |
| Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.1: Homeodomain-like [46689] (20 families) ![]() consists only of helices |
| Family a.4.1.2: Recombinase DNA-binding domain [46728] (5 proteins) |
| Protein Ibeta subdomain of the mu end DNA-binding domain of phage mu transposase [46735] (1 species) contains additional helix at each terminus |
| Species Bacteriophage Mu [TaxId:10677] [46736] (2 PDB entries) |
| Domain d2ezka_: 2ezk A: [16027] |
PDB Entry: 2ezk (more details)
SCOPe Domain Sequences for d2ezka_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ezka_ a.4.1.2 (A:) Ibeta subdomain of the mu end DNA-binding domain of phage mu transposase {Bacteriophage Mu [TaxId: 10677]}
miarptleahdydrealwskwdnasdsqrrlaekwlpavqaademlnqgistktafatva
ghyqvsastlrdkyyqvqkfakpdwaaalvdgr
Timeline for d2ezka_: