SCOPe 2.08: Domain d2ezka_: 2ezk A:

Lineage for d2ezka_ (2ezk A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.1: Homeodomain-like [46689] (21 families)
   consists only of helices

5. Family a.4.1.2: Recombinase DNA-binding domain [46728] (5 proteins)

6. Protein Ibeta subdomain of the mu end DNA-binding domain of phage mu transposase [46735] (1 species)
   contains additional helix at each terminus

7. Species Bacteriophage Mu [TaxId:10677] [46736] (2 PDB entries)

8. Domain d2ezka_: 2ezk A: [16027]
   has additional insertions and/or extensions that are not grouped together

Details for d2ezka_

PDB Entry: 2ezk

PDB Description: solution nmr structure of the ibeta subdomain of the mu end dna binding domain of phage mu transposase, regularized mean structure

PDB Compounds: (A:) transposase

SCOPe Domain Sequences for d2ezka_:

Sequence; same for both SEQRES and ATOM records:

>d2ezka_ a.4.1.2 (A:) Ibeta subdomain of the mu end DNA-binding domain of phage mu transposase {Bacteriophage Mu [TaxId: 10677]}
miarptleahdydrealwskwdnasdsqrrlaekwlpavqaademlnqgistktafatva
ghyqvsastlrdkyyqvqkfakpdwaaalvdgr

Timeline for d2ezka_:

• d2ezka_ first appeared (with stable ids) in SCOP 1.55, called d2ezk__
  
• d2ezka_ appears in SCOPe 2.07