Lineage for d2ezka_ (2ezk A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1981147Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1981148Superfamily a.4.1: Homeodomain-like [46689] (20 families) (S)
    consists only of helices
  5. 1981369Family a.4.1.2: Recombinase DNA-binding domain [46728] (5 protein domains)
  6. 1981394Protein Ibeta subdomain of the mu end DNA-binding domain of phage mu transposase [46735] (1 species)
    contains additional helix at each terminus
  7. 1981395Species Bacteriophage Mu [TaxId:10677] [46736] (2 PDB entries)
  8. 1981397Domain d2ezka_: 2ezk A: [16027]

Details for d2ezka_

PDB Entry: 2ezk (more details)

PDB Description: solution nmr structure of the ibeta subdomain of the mu end dna binding domain of phage mu transposase, regularized mean structure
PDB Compounds: (A:) transposase

SCOPe Domain Sequences for d2ezka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ezka_ a.4.1.2 (A:) Ibeta subdomain of the mu end DNA-binding domain of phage mu transposase {Bacteriophage Mu [TaxId: 10677]}
miarptleahdydrealwskwdnasdsqrrlaekwlpavqaademlnqgistktafatva
ghyqvsastlrdkyyqvqkfakpdwaaalvdgr

SCOPe Domain Coordinates for d2ezka_:

Click to download the PDB-style file with coordinates for d2ezka_.
(The format of our PDB-style files is described here.)

Timeline for d2ezka_: