Lineage for d2ezla_ (2ezl A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2691778Superfamily a.4.1: Homeodomain-like [46689] (21 families) (S)
    consists only of helices
  5. 2691999Family a.4.1.2: Recombinase DNA-binding domain [46728] (5 proteins)
  6. 2692024Protein Ibeta subdomain of the mu end DNA-binding domain of phage mu transposase [46735] (1 species)
    contains additional helix at each terminus
  7. 2692025Species Bacteriophage Mu [TaxId:10677] [46736] (2 PDB entries)
  8. 2692026Domain d2ezla_: 2ezl A: [16026]
    has additional insertions and/or extensions that are not grouped together

Details for d2ezla_

PDB Entry: 2ezl (more details)

PDB Description: solution nmr structure of the ibeta subdomain of the mu end dna binding domain of phage mu transposase, 29 structures
PDB Compounds: (A:) transposase

SCOPe Domain Sequences for d2ezla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ezla_ a.4.1.2 (A:) Ibeta subdomain of the mu end DNA-binding domain of phage mu transposase {Bacteriophage Mu [TaxId: 10677]}
miarptleahdydrealwskwdnasdsqrrlaekwlpavqaademlnqgistktafatva
ghyqvsastlrdkyyqvqkfakpdwaaalvdgrgasrrn

SCOPe Domain Coordinates for d2ezla_:

Click to download the PDB-style file with coordinates for d2ezla_.
(The format of our PDB-style files is described here.)

Timeline for d2ezla_: