![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.1: Homeodomain-like [46689] (21 families) ![]() consists only of helices |
![]() | Family a.4.1.2: Recombinase DNA-binding domain [46728] (5 proteins) |
![]() | Protein Ibeta subdomain of the mu end DNA-binding domain of phage mu transposase [46735] (1 species) contains additional helix at each terminus |
![]() | Species Bacteriophage Mu [TaxId:10677] [46736] (2 PDB entries) |
![]() | Domain d2ezla_: 2ezl A: [16026] has additional insertions and/or extensions that are not grouped together |
PDB Entry: 2ezl (more details)
SCOPe Domain Sequences for d2ezla_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ezla_ a.4.1.2 (A:) Ibeta subdomain of the mu end DNA-binding domain of phage mu transposase {Bacteriophage Mu [TaxId: 10677]} miarptleahdydrealwskwdnasdsqrrlaekwlpavqaademlnqgistktafatva ghyqvsastlrdkyyqvqkfakpdwaaalvdgrgasrrn
Timeline for d2ezla_: