Lineage for d1resa_ (1res A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2691778Superfamily a.4.1: Homeodomain-like [46689] (21 families) (S)
    consists only of helices
  5. 2691999Family a.4.1.2: Recombinase DNA-binding domain [46728] (5 proteins)
  6. 2692000Protein gamma,delta resolvase (C-terminal domain) [46731] (1 species)
  7. 2692001Species Escherichia coli [TaxId:562] [46732] (6 PDB entries)
  8. 2692013Domain d1resa_: 1res A: [16023]

Details for d1resa_

PDB Entry: 1res (more details)

PDB Description: determination of the structure of the dna binding domain of gamma delta resolvase in solution
PDB Compounds: (A:) gamma delta-resolvase

SCOPe Domain Sequences for d1resa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1resa_ a.4.1.2 (A:) gamma,delta resolvase (C-terminal domain) {Escherichia coli [TaxId: 562]}
grkrkidrdavlnmwqqglgashisktmniarstvykvinesn

SCOPe Domain Coordinates for d1resa_:

Click to download the PDB-style file with coordinates for d1resa_.
(The format of our PDB-style files is described here.)

Timeline for d1resa_: