Class a: All alpha proteins [46456] (290 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.1: Homeodomain-like [46689] (21 families) consists only of helices |
Family a.4.1.2: Recombinase DNA-binding domain [46728] (5 proteins) |
Protein gamma,delta resolvase (C-terminal domain) [46731] (1 species) |
Species Escherichia coli [TaxId:562] [46732] (6 PDB entries) |
Domain d1resa_: 1res A: [16023] |
PDB Entry: 1res (more details)
SCOPe Domain Sequences for d1resa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1resa_ a.4.1.2 (A:) gamma,delta resolvase (C-terminal domain) {Escherichia coli [TaxId: 562]} grkrkidrdavlnmwqqglgashisktmniarstvykvinesn
Timeline for d1resa_: