Lineage for d1gdtb1 (1gdt B:141-183)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 1223Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (11 superfamilies)
  4. 1224Superfamily a.4.1: Homeodomain-like [46689] (9 families) (S)
  5. 1312Family a.4.1.2: Recombinase DNA-binding domain [46728] (5 proteins)
  6. 1313Protein gamma,delta resolvase (C-terminal domain) [46731] (1 species)
  7. 1314Species Escherichia coli [TaxId:562] [46732] (3 PDB entries)
  8. 1316Domain d1gdtb1: 1gdt B:141-183 [16022]
    Other proteins in same PDB: d1gdta2, d1gdtb2

Details for d1gdtb1

PDB Entry: 1gdt (more details), 3 Å

PDB Description: crystal structure of a site-specific recombinase, gamma-delta resolvase complexed with a 34 bp cleavage site

SCOP Domain Sequences for d1gdtb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gdtb1 a.4.1.2 (B:141-183) gamma,delta resolvase (C-terminal domain) {Escherichia coli}
grkrkidrdavlnmwqqglgashisktmniarstvykvinesn

SCOP Domain Coordinates for d1gdtb1:

Click to download the PDB-style file with coordinates for d1gdtb1.
(The format of our PDB-style files is described here.)

Timeline for d1gdtb1:

1316
d1gdtb1 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d1gdtb2