SCOPe 2.03: Domain d1gdta1: 1gdt A:141-183

Lineage for d1gdta1 (1gdt A:141-183)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.1: Homeodomain-like [46689] (20 families)
   consists only of helices

5. Family a.4.1.2: Recombinase DNA-binding domain [46728] (5 proteins)

6. Protein gamma,delta resolvase (C-terminal domain) [46731] (1 species)

7. Species Escherichia coli [TaxId:562] [46732] (6 PDB entries)

8. Domain d1gdta1: 1gdt A:141-183 [16021]
   Other proteins in same PDB: d1gdta2, d1gdtb2
   protein/DNA complex

Details for d1gdta1

PDB Entry: 1gdt, 3 Å

PDB Description: crystal structure of a site-specific recombinase, gamma-delta resolvase complexed with a 34 bp cleavage site

PDB Compounds: (A:) protein (gamma delta resolvase)

SCOPe Domain Sequences for d1gdta1:

Sequence; same for both SEQRES and ATOM records:

>d1gdta1 a.4.1.2 (A:141-183) gamma,delta resolvase (C-terminal domain) {Escherichia coli [TaxId: 562]}
grkrkidrdavlnmwqqglgashisktmniarstvykvinesn

Timeline for d1gdta1:

• d1gdta1 first appeared (with stable ids) in SCOP 1.55
  
• d1gdta1 appears in SCOPe 2.02
  
• d1gdta1 appears in SCOPe 2.04
  
• d1gdta1 appears in the current release, SCOPe 2.08