Lineage for d1hcra_ (1hcr A:)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 1223Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (11 superfamilies)
  4. 1224Superfamily a.4.1: Homeodomain-like [46689] (9 families) (S)
  5. 1312Family a.4.1.2: Recombinase DNA-binding domain [46728] (5 proteins)
  6. 1319Protein HIN recombinase (DNA-binding domain) [46729] (1 species)
  7. 1320Species Synthetic [46730] (1 PDB entry)
  8. 1321Domain d1hcra_: 1hcr A: [16020]

Details for d1hcra_

PDB Entry: 1hcr (more details), 1.8 Å

PDB Description: hin recombinase bound to dna: the origin of specificity in major and minor groove interactions

SCOP Domain Sequences for d1hcra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hcra_ a.4.1.2 (A:) HIN recombinase (DNA-binding domain) {Synthetic}
grprainkheqeqisrllekghprqqlaiifgigvstlyryfpassikkrmn

SCOP Domain Coordinates for d1hcra_:

Click to download the PDB-style file with coordinates for d1hcra_.
(The format of our PDB-style files is described here.)

Timeline for d1hcra_: