Lineage for d1hcra_ (1hcr A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2691778Superfamily a.4.1: Homeodomain-like [46689] (21 families) (S)
    consists only of helices
  5. 2691999Family a.4.1.2: Recombinase DNA-binding domain [46728] (5 proteins)
  6. 2692014Protein HIN recombinase (DNA-binding domain) [46729] (1 species)
  7. 2692015Species Synthetic [46730] (8 PDB entries)
  8. 2692019Domain d1hcra_: 1hcr A: [16020]
    protein/DNA complex

Details for d1hcra_

PDB Entry: 1hcr (more details), 2.3 Å

PDB Description: hin recombinase bound to dna: the origin of specificity in major and minor groove interactions
PDB Compounds: (A:) protein (hin recombinase)

SCOPe Domain Sequences for d1hcra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hcra_ a.4.1.2 (A:) HIN recombinase (DNA-binding domain) {Synthetic}
grprainkheqeqisrllekghprqqlaiifgigvstlyryfpassikkrmn

SCOPe Domain Coordinates for d1hcra_:

Click to download the PDB-style file with coordinates for d1hcra_.
(The format of our PDB-style files is described here.)

Timeline for d1hcra_: