Lineage for d1fjlc_ (1fjl C:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1720410Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1720411Superfamily a.4.1: Homeodomain-like [46689] (20 families) (S)
    consists only of helices
  5. 1720412Family a.4.1.1: Homeodomain [46690] (41 proteins)
    Pfam PF00046
  6. 1720557Protein Paired protein [46726] (1 species)
  7. 1720558Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [46727] (1 PDB entry)
  8. 1720561Domain d1fjlc_: 1fjl C: [16019]
    protein/DNA complex

Details for d1fjlc_

PDB Entry: 1fjl (more details), 2 Å

PDB Description: homeodomain from the drosophila paired protein bound to a dna oligonucleotide
PDB Compounds: (C:) paired protein

SCOPe Domain Sequences for d1fjlc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fjlc_ a.4.1.1 (C:) Paired protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
kqrrsrttfsasqldelerafertqypdiytreelaqrtnlteariqvwfqnrrarlrk

SCOPe Domain Coordinates for d1fjlc_:

Click to download the PDB-style file with coordinates for d1fjlc_.
(The format of our PDB-style files is described here.)

Timeline for d1fjlc_: