Lineage for d1qrya_ (1qry A:)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 1223Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (11 superfamilies)
  4. 1224Superfamily a.4.1: Homeodomain-like [46689] (9 families) (S)
  5. 1225Family a.4.1.1: Homeodomain [46690] (18 proteins)
  6. 1306Protein VND/NK-2 protein [46724] (1 species)
  7. 1307Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [46725] (4 PDB entries)
  8. 1311Domain d1qrya_: 1qry A: [16016]

Details for d1qrya_

PDB Entry: 1qry (more details)

PDB Description: homeobox protein vnd (ventral nervous system defective protein)

SCOP Domain Sequences for d1qrya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qrya_ a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophila melanogaster)}
gshmsdglpnkkrkrrvlftkaqtyelerrfrqqrylsaperehltslirltptqvkiwf
qnhryktkraqnekgyeghp

SCOP Domain Coordinates for d1qrya_:

Click to download the PDB-style file with coordinates for d1qrya_.
(The format of our PDB-style files is described here.)

Timeline for d1qrya_: