Lineage for d1nk2p_ (1nk2 P:)
- Root: SCOP 1.55
Class a: All alpha proteins [46456] (138 folds) 
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (11 superfamilies) 
Superfamily a.4.1: Homeodomain-like [46689] (9 families) 
Family a.4.1.1: Homeodomain [46690] (18 proteins) 
Protein VND/NK-2 protein [46724] (1 species) Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [46725] (4 PDB entries) 
Domain d1nk2p_: 1nk2 P: [16015]
Details for d1nk2p_
PDB Entry: 1nk2 (more details)
PDB Description: vnd/nk-2 homeodomain/dna complex, nmr, 20 structures
SCOP Domain Sequences for d1nk2p_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nk2p_ a.4.1.1 (P:) VND/NK-2 protein {Fruit fly (Drosophila melanogaster)}
asdglpnkkrkrrvlftkaqtyelerrfrqqrylsaperehlaslirltptqvkiwfqnh
ryktkraqnekgyeghp
SCOP Domain Coordinates for d1nk2p_:
Click to download the PDB-style file with coordinates for d1nk2p_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1nk2p_:
- d1nk2p_ appears in SCOP 1.57
- d1nk2p_ appears in the current release, SCOPe 2.08
View in 3D