Lineage for d1nk3p_ (1nk3 P:)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 1223Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (11 superfamilies)
  4. 1224Superfamily a.4.1: Homeodomain-like [46689] (9 families) (S)
  5. 1225Family a.4.1.1: Homeodomain [46690] (18 proteins)
  6. 1306Protein VND/NK-2 protein [46724] (1 species)
  7. 1307Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [46725] (4 PDB entries)
  8. 1308Domain d1nk3p_: 1nk3 P: [16013]

Details for d1nk3p_

PDB Entry: 1nk3 (more details)

PDB Description: vnd/nk-2 homeodomain/dna complex, nmr, minimized average structure

SCOP Domain Sequences for d1nk3p_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nk3p_ a.4.1.1 (P:) VND/NK-2 protein {Fruit fly (Drosophila melanogaster)}
kkrkrrvlftkaqtyelerrfrqqrylsaperehlaslirltptqvkiwfqnhryktkra
qne

SCOP Domain Coordinates for d1nk3p_:

Click to download the PDB-style file with coordinates for d1nk3p_.
(The format of our PDB-style files is described here.)

Timeline for d1nk3p_: