SCOPe 2.08: Domain d1nk3p_: 1nk3 P:

Lineage for d1nk3p_ (1nk3 P:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.1: Homeodomain-like [46689] (21 families)
   consists only of helices

5. Family a.4.1.1: Homeodomain [46690] (41 proteins)
   Pfam PF00046

6. Protein VND/NK-2 protein [46724] (1 species)

7. Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [46725] (4 PDB entries)

8. Domain d1nk3p_: 1nk3 P: [16013]
   protein/DNA complex

Details for d1nk3p_

PDB Entry: 1nk3

PDB Description: vnd/nk-2 homeodomain/dna complex, nmr, minimized average structure

PDB Compounds: (P:) homeobox protein vnd

SCOPe Domain Sequences for d1nk3p_:

Sequence; same for both SEQRES and ATOM records:

>d1nk3p_ a.4.1.1 (P:) VND/NK-2 protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
kkrkrrvlftkaqtyelerrfrqqrylsaperehlaslirltptqvkiwfqnhryktkra
qne

Timeline for d1nk3p_:

• d1nk3p_ first appeared (with stable ids) in SCOP 1.55
  
• d1nk3p_ appears in SCOPe 2.07