Lineage for d1ftz__ (1ftz -)
- Root: SCOP 1.57
Class a: All alpha proteins [46456] (144 folds) 
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (10 superfamilies) 
Superfamily a.4.1: Homeodomain-like [46689] (10 families) 
Family a.4.1.1: Homeodomain [46690] (20 proteins) 
Protein Fushi Tarazu protein [46722] (1 species) Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [46723] (1 PDB entry) 
Domain d1ftz__: 1ftz - [16012]
Details for d1ftz__
PDB Entry: 1ftz (more details)
PDB Description: nuclear magnetic resonance solution structure of the fushi tarazu homeodomain from drosophila and comparison with the antennapedia homeodomain
SCOP Domain Sequences for d1ftz__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ftz__ a.4.1.1 (-) Fushi Tarazu protein {Fruit fly (Drosophila melanogaster)}
mdskrtrqtytryqtlelekefhfnryitrrrridianalslserqikiwfqnrrmkskk
drtldsspeh
SCOP Domain Coordinates for d1ftz__:
Click to download the PDB-style file with coordinates for d1ftz__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ftz__:
- d1ftz__ first appeared (with stable ids) in SCOP 1.55
- d1ftz__ appears in SCOP 1.59
- d1ftz__ appears in the current release, SCOPe 2.08, called d1ftza_
View in 3D