Lineage for d1b8ib_ (1b8i B:)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 1223Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (11 superfamilies)
  4. 1224Superfamily a.4.1: Homeodomain-like [46689] (9 families) (S)
  5. 1225Family a.4.1.1: Homeodomain [46690] (18 proteins)
  6. 1245Protein Extradenticle (exd) homeodomain [46720] (1 species)
  7. 1246Species Drosophila melanogaster [TaxId:7227] [46721] (1 PDB entry)
  8. 1247Domain d1b8ib_: 1b8i B: [16011]
    Other proteins in same PDB: d1b8ia_

Details for d1b8ib_

PDB Entry: 1b8i (more details), 2.4 Å

PDB Description: structure of the homeotic ubx/exd/dna ternary complex

SCOP Domain Sequences for d1b8ib_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b8ib_ a.4.1.1 (B:) Extradenticle (exd) homeodomain {Drosophila melanogaster}
rrnfskqaseilneyfyshlsnpypseeakeelarkcgitvsqvsnwfgnkrirykkn

SCOP Domain Coordinates for d1b8ib_:

Click to download the PDB-style file with coordinates for d1b8ib_.
(The format of our PDB-style files is described here.)

Timeline for d1b8ib_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1b8ia_