![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.1: Homeodomain-like [46689] (21 families) ![]() consists only of helices |
![]() | Family a.4.1.1: Homeodomain [46690] (41 proteins) Pfam PF00046 |
![]() | Protein Extradenticle (exd) homeodomain [46720] (1 species) |
![]() | Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [46721] (1 PDB entry) |
![]() | Domain d1b8ib_: 1b8i B: [16011] Other proteins in same PDB: d1b8ia_ protein/DNA complex |
PDB Entry: 1b8i (more details), 2.4 Å
SCOPe Domain Sequences for d1b8ib_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1b8ib_ a.4.1.1 (B:) Extradenticle (exd) homeodomain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} rrnfskqaseilneyfyshlsnpypseeakeelarkcgitvsqvsnwfgnkrirykkn
Timeline for d1b8ib_: