Lineage for d1b8ib_ (1b8i B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2691778Superfamily a.4.1: Homeodomain-like [46689] (21 families) (S)
    consists only of helices
  5. 2691779Family a.4.1.1: Homeodomain [46690] (41 proteins)
    Pfam PF00046
  6. 2691821Protein Extradenticle (exd) homeodomain [46720] (1 species)
  7. 2691822Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [46721] (1 PDB entry)
  8. 2691823Domain d1b8ib_: 1b8i B: [16011]
    Other proteins in same PDB: d1b8ia_
    protein/DNA complex

Details for d1b8ib_

PDB Entry: 1b8i (more details), 2.4 Å

PDB Description: structure of the homeotic ubx/exd/dna ternary complex
PDB Compounds: (B:) protein (homeobox protein extradenticle)

SCOPe Domain Sequences for d1b8ib_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b8ib_ a.4.1.1 (B:) Extradenticle (exd) homeodomain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
rrnfskqaseilneyfyshlsnpypseeakeelarkcgitvsqvsnwfgnkrirykkn

SCOPe Domain Coordinates for d1b8ib_:

Click to download the PDB-style file with coordinates for d1b8ib_.
(The format of our PDB-style files is described here.)

Timeline for d1b8ib_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1b8ia_