SCOP 1.57: Domain d1b8ia_: 1b8i A:

Lineage for d1b8ia_ (1b8i A:)

1. Root: SCOP 1.57

2. Class a: All alpha proteins [46456] (144 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (10 superfamilies)

4. Superfamily a.4.1: Homeodomain-like [46689] (10 families)

5. Family a.4.1.1: Homeodomain [46690] (20 proteins)

6. Protein Ultrabithorax (ubx) homeodomain [46718] (1 species)

7. Species Drosophila melanogaster [TaxId:7227] [46719] (1 PDB entry)

8. Domain d1b8ia_: 1b8i A: [16010]
   Other proteins in same PDB: d1b8ib_

Details for d1b8ia_

PDB Entry: 1b8i, 2.4 Å

PDB Description: structure of the homeotic ubx/exd/dna ternary complex

SCOP Domain Sequences for d1b8ia_:

Sequence, based on SEQRES records:

>d1b8ia_ a.4.1.1 (A:) Ultrabithorax (ubx) homeodomain {Drosophila melanogaster}
fypwmaiagtnglrrrgrqtytryqtlelekefhtnhyltrrrriemahalslterqiki
wfqnrrmklkkei

Sequence, based on observed residues (ATOM records):

>d1b8ia_ a.4.1.1 (A:) Ultrabithorax (ubx) homeodomain {Drosophila melanogaster}
fypwmarqtytryqtlelekefhtnhyltrrrriemahalslterqikiwfqnrrmklkk
ei

Timeline for d1b8ia_:

• d1b8ia_ first appeared (with stable ids) in SCOP 1.55
  
• d1b8ia_ appears in SCOP 1.59
  
• d1b8ia_ appears in the current release, SCOPe 2.08