SCOPe 2.05: Domain d2hoaa_: 2hoa A:

Lineage for d2hoaa_ (2hoa A:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.1: Homeodomain-like [46689] (20 families)
   consists only of helices

5. Family a.4.1.1: Homeodomain [46690] (41 proteins)
   Pfam PF00046

6. Protein Antennapedia Homeodomain [46716] (1 species)

7. Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [46717] (5 PDB entries)

8. Domain d2hoaa_: 2hoa A: [16009]

Details for d2hoaa_

PDB Entry: 2hoa

PDB Description: structure determination of the antp(c39->s) homeodomain from nuclear magnetic resonance data in solution using a novel strategy for the structure calculation with the programs diana, caliba, habas and glomsa

PDB Compounds: (A:) antennapedia protein

SCOPe Domain Sequences for d2hoaa_:

Sequence; same for both SEQRES and ATOM records:

>d2hoaa_ a.4.1.1 (A:) Antennapedia Homeodomain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
mrkrgrqtytryqtlelekefhfnryltrrrrieiahalslterqikiwfqnrrmkwkke
nktkgepg

Timeline for d2hoaa_:

• d2hoaa_ first appeared (with stable ids) in SCOP 1.55, called d2hoa__
  
• d2hoaa_ appears in SCOPe 2.04
  
• d2hoaa_ appears in SCOPe 2.06
  
• d2hoaa_ appears in the current release, SCOPe 2.08, called d2hoaa1