Lineage for d2hoaa1 (2hoa A:1-67)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2304501Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2304502Superfamily a.4.1: Homeodomain-like [46689] (20 families) (S)
    consists only of helices
  5. 2304503Family a.4.1.1: Homeodomain [46690] (41 protein domains)
    Pfam PF00046
  6. 2304504Protein Antennapedia Homeodomain [46716] (1 species)
  7. 2304505Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [46717] (5 PDB entries)
  8. 2304510Domain d2hoaa1: 2hoa A:1-67 [16009]
    Other proteins in same PDB: d2hoaa2

Details for d2hoaa1

PDB Entry: 2hoa (more details)

PDB Description: structure determination of the antp(c39->s) homeodomain from nuclear magnetic resonance data in solution using a novel strategy for the structure calculation with the programs diana, caliba, habas and glomsa
PDB Compounds: (A:) antennapedia protein

SCOPe Domain Sequences for d2hoaa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hoaa1 a.4.1.1 (A:1-67) Antennapedia Homeodomain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
rkrgrqtytryqtlelekefhfnryltrrrrieiahalslterqikiwfqnrrmkwkken
ktkgepg

SCOPe Domain Coordinates for d2hoaa1:

Click to download the PDB-style file with coordinates for d2hoaa1.
(The format of our PDB-style files is described here.)

Timeline for d2hoaa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2hoaa2