| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.1: Homeodomain-like [46689] (21 families) ![]() consists only of helices |
| Family a.4.1.1: Homeodomain [46690] (41 proteins) Pfam PF00046 |
| Protein Antennapedia Homeodomain [46716] (1 species) |
| Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [46717] (5 PDB entries) |
| Domain d2hoaa1: 2hoa A:1-67 [16009] Other proteins in same PDB: d2hoaa2 |
PDB Entry: 2hoa (more details)
SCOPe Domain Sequences for d2hoaa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hoaa1 a.4.1.1 (A:1-67) Antennapedia Homeodomain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
rkrgrqtytryqtlelekefhfnryltrrrrieiahalslterqikiwfqnrrmkwkken
ktkgepg
Timeline for d2hoaa1: