SCOPe 2.07: Domain d1sana_: 1san A:

Lineage for d1sana_ (1san A:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.1: Homeodomain-like [46689] (20 families)
   consists only of helices

5. Family a.4.1.1: Homeodomain [46690] (41 protein domains)
   Pfam PF00046

6. Protein Antennapedia Homeodomain [46716] (1 species)

7. Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [46717] (5 PDB entries)

8. Domain d1sana_: 1san A: [16008]

Details for d1sana_

PDB Entry: 1san

PDB Description: the des(1-6)antennapedia homeodomain: comparison of the nmr solution structure and the dna binding affinity with the intact antennapedia homeodomain

PDB Compounds: (A:) antennapedia protein

SCOPe Domain Sequences for d1sana_:

Sequence; same for both SEQRES and ATOM records:

>d1sana_ a.4.1.1 (A:) Antennapedia Homeodomain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
mtytryqtlelekefhfnryltrrrrieiahalslterqikiwfqnrrmkwkkenktkge
pg

Timeline for d1sana_:

• d1sana_ first appeared (with stable ids) in SCOP 1.55, called d1san__
  
• d1sana_ appears in SCOPe 2.06